PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G026300.1
Common NameB456_008G026300, LOC105762834
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 410aa    MW: 45634.2 Da    PI: 8.5618
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G026300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.56.2e-33264319156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Gorai.008G026300.1 264 KQRRCWSPELHRRFVNALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 319
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.115261321IPR017930Myb domain
SuperFamilySSF466893.58E-18261322IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-29262322IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-27264319IPR006447Myb domain, plants
PfamPF002496.4E-8266317IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MGSVPPELSL DFRPTFVPKT ICTFLKEVSL IGNVPDKVSK LDAFVKRLEE EMRKIDAFKR  60
ELPLCMLLLN DAIVALKEES VQCMSRNVEP VLEEFIPLKN KKENNRSEED GALITNKKEK  120
DSNNNCNNNK DKKNWMSSVQ LWNTDDDYSS ISHKLDSKRK DGDSSQGCKN RGTATAFMPF  180
KMNLGFAVRK EEKEEIPVHG LTLLTPGIKN LKEESCSTGS RTSCSRAVSS SAPNAQSTFR  240
SVPQPLSHHQ QQQQQQQQQQ TARKQRRCWS PELHRRFVNA LQQLGGSQVA TPKQIRELMQ  300
VDGLTNDEVK SHLQKYRLHT RRVPASTTSP ANQSVVVLGS GLWMSQDQYG ESSKGSSSQS  360
GSPQGPLQLA TNTGGTSNPG GDSMEDDEDA KSESYSWKSH IHKPGKDDV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00193DAPTransfer from AT1G49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012436209.10.0PREDICTED: uncharacterized protein LOC105762834
TrEMBLA0A0D2SZ850.0A0A0D2SZ85_G
STRINGVIT_03s0063g01060.t011e-169(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM145351021
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.18e-50G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]